PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009617435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 202aa    MW: 23779.7 Da    PI: 9.5844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009617435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.11.1e-09952344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT  Ed+l+ +a  +++ g   +W +Ia +++ g++++++  ++
   XP_009617435.1  9 TWTRYEDKLFEEALVMYPEGvvnRWQKIAIHVP-GKSPEDVMAHY 52
                     7********************************.********998 PP

2Myb_DNA-binding445.1e-14112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_009617435.1 112 PWTPEEHRLFLIGLERYGKGDWRSISRNVVVTRTPMQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.7559IPR017884SANT domain
SMARTSM007172.5E-8658IPR001005SANT/Myb domain
PfamPF002498.2E-9852IPR001005SANT/Myb domain
SuperFamilySSF466892.84E-12864IPR009057Homeodomain-like
CDDcd001675.04E-8952No hitNo description
Gene3DG3DSA:1.10.10.604.5E-5956IPR009057Homeodomain-like
PROSITE profilePS5129421.666105161IPR017930Myb domain
SuperFamilySSF466892.08E-17105162IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-16108160IPR006447Myb domain, plants
SMARTSM007173.1E-12109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-12109158IPR009057Homeodomain-like
PfamPF002497.1E-12112156IPR001005SANT/Myb domain
CDDcd001672.04E-9112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MYMIHSTSTW TRYEDKLFEE ALVMYPEGVV NRWQKIAIHV PGKSPEDVMA HYDALVHDVF  60
VIDSGRVDIP SYNHRSSEWE PESGTRTRTS HNISFESNYK NHAEQIRKKG TPWTPEEHRL  120
FLIGLERYGK GDWRSISRNV VVTRTPMQVA SHAQKYFKRQ ESMKKKERKR SSIHDITVDT  180
NILLPQNNNQ NQGVYQNYNF PL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157169KRQESMKKKERKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617435.11e-152PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016510464.11e-152PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H79e-52DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK4D4T31e-94K4D4T3_SOLLC; Uncharacterized protein
STRINGSolyc11g006720.1.13e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-59MYB family protein